ELF $4 4 ( 4 4
x l l Pdd$ $ o /lib/ld.so.1 ;đ g h
" # $ % ' ) + , - / 2 4 6 7 9 : ; < = ? A B C D F G H I J L M N O R T U V W Y Z \ ] ^ _ ` a c f g
! & ( * . 0 1 3 5 8 > @ E K P Q S X [ b d e
* * % A < A % Q L Q % * ] j q } % L& &T &! '^ }'T 'C ( )? *~ * )+c ' , 0 c-> < - P q/2 d 0 n _1 u 2 } 2 5a 36 70 M8h 8i : ? KD QE1 E! E! E & Fi 2 G
5 J+ = -Nd U K LX Y eZ d d^e v _6 `
e- 9g )j1 } p ! @ ! 1% Zm v $! T$ ' # . " 9 # @ # K T @q \ a " k $$ u $ # {
! q# # ! t $ 0% " ! d# 4 " ! ! D# * d$ 1 $ 9 ! A P ! ` $ k x r D " $ T t# d 4# : # d! `q D" " " " ! t" Z $ : # A d" G " O # V j 4" q D! z # $" T! ! t! " 8 D$ " @ F $# 4! T" T#
4$ & l / 4 # newroute crt1.o mach-crt1.s ./fsr.s ia32/sys/asm_linkage.h ia32/sys/trap.h ia32/sys/stack.h common-crt.c crti.s values-Xa.c crtstuff.c __do_global_dtors_aux frame_dummy route.c in_prefixlentomask salen quit usage rtsa_keyword print_rtcmd_short new_rtcmd_irep compare_rtcmd set_metric link_addr sockaddr save_string inet_makesubnetmask inet_makenetandmask link_ntoa sodump bprintf routename del_rtcmd_irep pmsg_secattr pmsg_addrs pmsg_common print_rtmsg print_getmsg write_to_rtfile syntax_error syntax_arg_missing syntax_bad_keyword in_getprefixlen in6_getaddr in_getaddr args_to_rtcmd search_rtfile save_route show_saved_routes rtmonitor mibget netname delRouteEntry flushroutes __do_global_ctors_aux crtn.s optarg __deregister_frame_info_bases freehostent __iob bcopy _start_crt socket textdomain getpid fdopen inet_lnaof fclose fcntl tsol_strerror _fini atexit inet_addr setlocale __fsr _PROCEDURE_LINKAGE_TABLE_ is_system_labeled _init strncpy memcmp optind free strcmp _mcount htonl fopen inet_ntoa __fpstart gethostbyname gethostbyaddr sprintf if_nametoindex strlen _start _environ __environ_lock getipnodebyaddr setsockopt _edata __register_frame_info_bases inet_ntop getnetbyname _etext getnetbyaddr calloc fstat ___errno shutdown strchr _lib_version read strtoul vfprintf getipnodebyname rtsa_to_str fputs _GLOBAL_OFFSET_TABLE_ rename fseek strlcpy putmsg _Jv_RegisterClasses perror __flsbuf strtok write gethostname __fsr_init_value memcpy strcpy memmove memset ioctl gettext getopt ___Argv time fflush snprintf fgets _start_crt_compiler malloc _end ntohl strdup _DYNAMIC atoi __longdouble_used libsocket.so.1 SUNW_1.4 SUNW_0.7 libnsl.so.1 SUNW_1.7 SUNWprivate_1.1 libtsnet.so.1 libc.so.1 SUNW_1.22.2 SUNW_1.19 SUNW_1.1 SUNW_0.9 SYSVABI_1.3 F 0 '=
U (=
^ g @ '=
s (=
^ qN | qN | y y '=
(=
(=
^ 7
` s ^ i P ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F R b Z u t K f 0M $] 8 @/ HG @X A (] ,# 4 < D/ L_ P TT X \" `0 d4 h6 l pe tQ x |c R ^ a N Z I L 9 O % & , Đ Ȑ ̐? АW ԐP ؐK ܐH ; [ D @ = < E > $ 1 J Y 7 ' $\ (! ,5 0 4 8g <
@C D8 HF L P3 T- X \b `U d
h( 5% %h %(h %,h %4h %<h %Dh( %Lh0 %Ph8 p%Th@ `%XhH P%\hP @%`hX 0%dh` %hhh %lhp %phx %th %xh %|h %h %h %h %h %h p%h `%h P%h @%h 0%h %h %h %h %h %h %h %h %Đh %Ȑh( %̐h0 %Аh8 p%Ԑh@ `%ؐhH P%ܐhP @%hX 0%h` %hh %hp %hx %h %h %h % h %h %h % h %h p%h `%h P% h @% h 0%$h %(h %,h %0h %4h %8h %<h %@h %Dh %Hh( %Lh0 %Ph8 p%Th@ `%XhH P%\hP @%`hX 0%dh` %hhh j j RU ERP t& URQS [Rk M t\<$ʃ $ t$$ʃ`tЃ 1f$$f $ t f$$f $,$[YZ]Í ' UWVS [j }u t u4 #T 0$ t
VW 0 ZK 0VWG $UVS [&j uY p l )N9sf@ l 9r苃8 t Pƃ e[^fUS [èi @ tSj P Pet tH t t RЃ]WVSD$T$x5;D$/~2 ~ B
)
H [^_ËD$f fv @~UVSu] h~h`tVh~h` S Ph~h` $GUS]t h~| SPh`M hdq]Ph`/$ UVSuu! tVP!uCe[^UWVS bm,JySP SBS ~4JySP SBSF F> vt#HySj>e
C >@Ce[^_UWVS,]= tT h h`-u*j.h`'t@Ph`!` Su hh2 ff f f CEuX= uvjjEPÃt]j.0vƃth`@P u t'h Phi uERR RPhh- < S+ }ԍs } u } u} u} u ]= EPjjEPÃtUj.0kƃth`@Pu t h Ph^ j.hEPjt` S`Rx<;Rhh9s$PhVƃ9w⸀e[^_û pUS]8 8 0 4 txu P Sy]UWVSl ] } C\9 ujVSv}t]C\9s uS 439ryjTEPS9{TET9uStO u~jPVWPh PV PuhC9]we[^_UWVS ]u } h huhPPHyRj
T
B43uC9 ut4 SGPhg $9 H@ t GC9EsZu)ރhVS3PHyRj
(
T
B hPe[^_þ US]h h s$hP$ h s hP s E LPLSp]UVS]u = J C<tPhq?* 9tVPhq!9~ƊCPvPh0r V4}h!C < ${C Ph. h shP sTVTS}rsh=o h@shPR sVS@5ssshXr/ h@shPVS9e[^UWVS8E u E U hj u S z } t URuPVjE f N Z N N u E U hj u S uPh Vg N uE E Ehj 1Eԃ} u S 4 ~" hPt$1 \ j URuuu70u$tSP
4 ht$ N CS F8u uSjV# u uSjV n P j
EPSkE38 uGE8 u?} x9} Eă= tBuPht uSjVvu E u E U hj GÃF8u" h6$k Jw#u h$u$= k} uN}tVF8t>~u
@ uN~u7jhD PuNN e[^_UWVSL8Ãj uP~;t = uj 5dC8tr 0 ]f6 fuLi8t_0h3 0 hB SPh`$ fǃ4 < E@ E S5ƃtq8 t
8uZC8tT4 tJP :t@ttu0p QuCp Qu/ro8;t6j PShP h~ = tvCtuQ! s@Ph j.EPCDPjtEPhx8 hp`8 hXH`w WPh$ Se[^_Ãt tut u듸뭸UWVS, Džadd Dž Dž <#t<
u@}u u V] hXu@SPA@ Pǃ Pj Su S<$y W^8 u Sw } u
C;tu!Sut } S4}uvBPhg jj ShP:$~>fu V}u ` h˂SPuh V&We[^_Ã}t SrUWVS u. h h 5ЛÃt ] cmd [[ - ] args ]
ioctl (get interface configuration) routing message version %d not understood
message length mismatch, in packet %d, returned %d
routing message type %d not understood
pid: %ld, seq %d, errno %d, flags: interface: %.*s index %d address recvpipe sendpipe ssthresh rtt,ms rttvar,ms hopcount mtu expire route: write to routing socket got only %d for len
route: read from routing socket: %s
route: argument required following keyword %s
route: prefix length %s out of range
route: %s: bad address (try again later)
route: -netmask not supported for IPv6: use / instead
route: -host and -net are mutually exclusive
route: can't specify more than one security attribute
route: bad security attribute: %s
route: system is not labeled; cannot specify security attributes.
old usage of trailing number, assuming route %s
route: gateway required for add or delete command
route: failed to write to temp file route: change command not supported with -p
# File generated by route(1M) - do not edit.
route: invalid arguments for show
No persistent routes are defined
mibget getmsg() %d returned EOD (level %lu, name %lu)
mibget %d gives T_ERROR_ACK: TLI_error = 0x%lx, UNIX_error = 0x%lx
mibget getmsg(ctl) %d returned %d, ctlbuf.len = %d, PRIM_type = %ld
T_OPTMGMT_ACK: MGMT_flags = 0x%lx, req->len = %ld
msg %d: group = %4ld mib_id = %5ld length = %ld
mibget getmsg(data) returned %d, databuf.maxlen = %d, databuf.len = %d
route: write to routing socket: %s
route: write to routing socket got only %d for rlen
route: flush: insufficient privileges
Examining routing table from T_SVR4_OPTMGMT_REQ
ipRouteEntrySize can't be determined.
ipv6RouteEntrySize cannot be determined.
route: show command requires -p
RTM_CHANGE: Change Metrics or flags RTM_LOSING: Kernel Suspects Partitioning RTM_REDIRECT: Told to use different route RTM_MISS: Lookup failed on this address RTM_LOCK: fix specified metrics RTM_OLDADD: caused by SIOCADDRT RTM_OLDDEL: caused by SIOCDELRT RTM_RESOLVE: Route created by cloning RTM_NEWADDR: address being brought up on iface RTM_DELADDR: address being brought down on iface RTM_IFINFO: iface status change RTM_CHGADDR: address being changed on iface RTM_FREEADDR: address being removed from iface **************************** +***+, ,V,,,F,F,r,+,,,,,,+F-"--/-[-@-@-99f999SSOSOS&QQSPSSQ-O!POxPOOOOONSSQaO}QO9ROOQOQQOQQP PERQRRS
nnnnnnnnnnnnnnnnnnmnmnnnnnnnmnmmnnmnmp
pp
pp
pppppp
pppppppppppppppppppppppppppppppp[p0123456789abcdef ~oxx yHypyyyyy(z\z|zz route: %s:
%s
route: botched keyword: %s
add change delete mibget NULL inet host persistent %s%s %s %s : gateway %s : gateway %s (%s) calloc mibget: malloc writing to routing socket ioctl ioctl (get interface flags) ioctl (get netmask) %s: link %s; %s: inet %s; %s: inet6 %s; Internal Error default %u.%u.%u.%u (%d) %x
%s%s
sockaddrs: secattr:
locks: inits: %s: len %d, if# %d, flags: metric %d, flags: route to: %s
RTM_GET: %s (errno %d)
mask: %s
gateway: %s
setsrc: %s
%02x interface: %.*s
flags: %8d%c %8d%c destination: %s
newrt->ri_dst newrt->ri_gate newrt->ri_mask newrt->ri_ifp newrt->ri_ifa newrt->ri_src -inet6 %s failed to write to route file route: %s: unexpected '/'
route: bad prefix length %s
route: %s: bad address
255.255.255.255 %s: bad value
route: bad prefix length: %d
via gateway to if route: destination required
if_nametoindex route: %s: no such interface
routing table overflow entry exists insufficient privileges entry in use not in table persistent: route %s failed to write to temp file failed to open route file failed to lock route file r+ show failed to open temp file failed to update route file : entry exists
: not in file
rttvar read got message of size %d
mibget: putmsg (ctl) mibget: getmsg (ctl) # level name len
%d %4ld %5ld %ld
mibget: getmsg (data) af %d: %-20.20s done
setsockopt /dev/ip can't open mib stream SUNW_OST_OSCMD R:nqdtvfp /dev/null RTM_ADD: Add Route RTM_DELETE: Delete Route RTM_GET: Report Metrics blackhole cloning expire flush hopcount iface inet6 interface link lock lockrest netmask monitor mtu nostatic private proto1 proto2 recvpipe reject rtt sa sendpipe ssthresh xresolve multirt setsrc secattr indirect l l @q
* : J Z j z
!!*!:!J!Z!j!z!!!!!!!!!
""*":"J"Z"j"z"""""""""
##*#:#J#Z#j#z#########
$$*$:$J$Z$j$o F o g o q
@q 4
` ` ` ` ` o u o o p o0o o o ` `> XM /etc/inet/static_routes /etc/inet/static_routes.tmp ~ ~ ~ ń ̄ ~ ҄ ~
4 ۄ & ~ ~ ! ) 0 7 @! G" x# K$ N% W& ' `( i) q* + x+ , UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC
ALLMULTI INTELLIGENT MULTICAST
MULTI_BCASTUNNUMBEREDDHCPPRIVATENOXMITNOLOCALDEPRECATEDADDRCONFROUTERNONUDANYCASTNORTEXCHIPv4IPv6 NOFAILOVER FAILED STANDBY INACTIVE OFFLINE!XRESOLV"COS#PREFERRED$TEMPORARY%FIXEDMTU&VIRTUAL'DUPLICATE UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING
XRESOLVE LLINFO STATIC
BLACKHOLEPRIVATEPROTO2PROTO1MULTIRTSETSRCINDIRECTKERNELZONE DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD SRC pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtu $ 0
4
$ q @q `q l d l t p 8
* * % A < A % Q L Q % * ] h u | d l t % L& " &T 5 &! ; @~d F '^ K }'T V 'C ^ h g ( y )? t *~ * )+c , c-> - q/2 0 @ } _1 . 2 ( 2 2 = ` I S 5a b 36 o 70 z 4 M8h B 8i }H 7 @ : ? L KD ̛ % QE1 2 @ E! S E! f E v Fi G
J+ -Nd U LX eZ Л ԛ d^e _6 `
e- 9g % )j1 1 ț ; ě H , Y 0 l r @ X h t p ! , @ 1 ! 7 1% B O Zm ! $! T$ T # [ " f # m # x @q " $$ $ Q #
! q# # ! t $ 0% " ! d# 4 $ " 2 ! @ ! H D# W d$ ^ $ f ! n } ! $ x D " $ T t# d 4# g # d! `q D" " & " / " ? ! K t" Q g # n d" t " | # 4" D! # $" T! ! t! " e D$ " + @ s $# 4! T" T# 4 ' ; @ I 4$ F M l V [
# newroute crt1.o mach-crt1.s ./fsr.s ia32/sys/asm_linkage.h ia32/sys/trap.h ia32/sys/stack.h trap_table common-crt.c crti.s values-Xa.c crtstuff.c __CTOR_LIST__ __DTOR_LIST__ __EH_FRAME_BEGIN__ __JCR_LIST__ __do_global_dtors_aux completed.4700 dtor_idx.4702 frame_dummy object.4726 route.c in_prefixlentomask salen CSWTCH.212 quit usage rtsa_keyword keywords print_rtcmd_short nflag new_rtcmd_irep af compare_rtcmd set_metric link_addr sockaddr save_string inet_makesubnetmask inet_makenetandmask link_ntoa obuf.10701 hexlist sodump obuf.10563 bprintf routename first.8607 domain.8606 line.8604 del_rtcmd_irep pmsg_secattr pmsg_addrs addrnames pmsg_common metricnames print_rtmsg verbose msgtypes ifnetflags routeflags print_getmsg m_rtmsg seq.9982 debugonly fgets getpid write_to_rtfile early_v6_keyword syntax_error exit_on_error syntax_arg_missing syntax_bad_keyword in_getprefixlen in6_getaddr in_getaddr args_to_rtcmd in6_host_mask tflag search_rtfile save_route perm_file temp_file show_saved_routes rtmonitor mibget netname line.8714 delRouteEntry qflag flushroutes perm_flag update_table ipRouteEntrySize ipv6RouteEntrySize fflag perm_file_sfx temp_file_sfx __CTOR_END__ __FRAME_END__ __JCR_END__ __do_global_ctors_aux crtn.s _END_ __DTOR_END__ __dso_handle _START_ optarg __deregister_frame_info_bases freehostent __iob bcopy _start_crt socket textdomain fdopen inet_lnaof fclose fcntl tsol_strerror _fini atexit inet_addr setlocale __fsr _PROCEDURE_LINKAGE_TABLE_ is_system_labeled _init strncpy memcmp optind free strcmp _mcount htonl fopen inet_ntoa __fpstart gethostbyname gethostbyaddr sprintf if_nametoindex strlen _start _environ __environ_lock getipnodebyaddr setsockopt _edata __register_frame_info_bases inet_ntop getnetbyname _etext getnetbyaddr calloc fstat ___errno shutdown strchr _lib_version read strtoul vfprintf getipnodebyname rtsa_to_str fputs _GLOBAL_OFFSET_TABLE_ rename fseek strlcpy putmsg _Jv_RegisterClasses perror __flsbuf strtok write gethostname __fsr_init_value memcpy strcpy memmove memset ioctl gettext getopt ___Argv time fflush snprintf _start_crt_compiler malloc _end ntohl strdup _DYNAMIC atoi __longdouble_used @(#)SunOS 5.11 titanic_53 July 2025 .interp .eh_frame_hdr .SUNW_syminfo .hash .SUNW_ldynsym .dynsym .dynstr .SUNW_version .SUNW_versym .SUNW_dynsymsort .SUNW_reloc .rel.plt .text .init .fini .rodata .got .dynamic .eh_frame .data .ctors .dtors .jcr .bss .symtab .strtab .comment .shstrtab
$$ oB 00 % D + o J 9
A " 44 I o W o d o u @ B p
$$ L qq # @q@q `q`q ) l ll b dd ll tt @ x m %